DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and neurog1

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001116895.1 Gene:neurog1 / 100144651 XenbaseID:XB-GENE-491452 Length:227 Species:Xenopus tropicalis


Alignment Length:229 Identity:59/229 - (25%)
Similarity:101/229 - (44%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 VQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERN---------MRRLESNERERMR 168
            :|.||..:.....:|..|.........    :||..:.::.:|         .||:::|:|||.|
 Frog    27 MQSASPFSSEHMSSPAQTPEKCQEEKD----KRKKRVRSRVKNDAVLHTIKKTRRVKANDRERNR 87

  Fly   169 MHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHII-LSKRNEEAAALELNSGAVGG 232
            ||:||.|...||.::|....:.:|:|||||.||.|||..|:..: |:.:::|.....|...|   
 Frog    88 MHNLNSALDELRGILPSFPDDTKLTKIETLRLAHNYIWALSETLRLADQSKEKPLKNLGHPA--- 149

  Fly   233 VLLSNLSSESGGP-----VASGIPANSNAA----TICFEDTLASGGAFDCAILAATDGSLLNAAT 288
             .||..:..|.|.     ::|..|::|:::    ::|.....:...:.|| ....|| ||.    
 Frog   150 -YLSPATPPSPGSDAESWMSSSSPSSSSSSSSSFSVCTSSPSSPAMSEDC-YYGHTD-SLF---- 207

  Fly   289 VTTSPAMQSIQSQAIHLQTPMEQQQQQASHLPHH 322
                 ::.::|...|         |..:|.|.:|
 Frog   208 -----SLHTLQQNMI---------QHASSFLQYH 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 27/62 (44%)
neurog1NP_001116895.1 HLH 73..132 CDD:238036 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.