DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and twist2

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001096679.1 Gene:twist2 / 100125350 XenbaseID:XB-GENE-5878700 Length:162 Species:Xenopus tropicalis


Alignment Length:121 Identity:36/121 - (29%)
Similarity:56/121 - (46%) Gaps:32/121 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 IAPNSTSSNSSNANGNASRRRKGALNAK------------------ERNMR-------------R 158
            :.|:|...:...:...|.|:::.|:..:                  :||.|             |
 Frog     6 VCPDSPEGSMVTSEEEADRQQRKAIRKRTILVGKPSEGRVPLSPPCKRNKRSPHIETFEDVHTQR 70

  Fly   159 LESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILS 214
            :.:|.|||.|..||||||..||::||.:..: :||||:||.||..||..|..::.|
 Frog    71 IIANVRERQRTQSLNDAFAELRKIIPTLPSD-KLSKIQTLKLASRYIDFLYQVLQS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 29/66 (44%)
twist2NP_001096679.1 bHLH_SF 61..134 CDD:381792 28/66 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.