DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and neurod4

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001124513.1 Gene:neurod4 / 100124310 XenbaseID:XB-GENE-972704 Length:316 Species:Xenopus tropicalis


Alignment Length:272 Identity:68/272 - (25%)
Similarity:102/272 - (37%) Gaps:74/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNS 129
            ::|.....|..|..||             ..|...||:.|:...     ::...|..|....|  
 Frog    20 EMERNQRQSAYDIISG-------------LSHEERCSIDGEDDD-----EEEEDGEKPKKRGP-- 64

  Fly   130 TSSNSSNANGNASRRRKGALNAKER-NMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLS 193
                         :::|......|| .:||:::|.|||.|||.||||.::||.|:|.....::||
 Frog    65 -------------KKKKMTKARLERFRVRRVKANARERTRMHGLNDALENLRRVMPCYSKTQKLS 116

  Fly   194 KIETLTLAKNYIINLTHIILSKRNEEAAA-LEL--------NSGAVGGVLLSNLSSESGGPVASG 249
            |||||.||:|||..|:.|:...::.|... ||:        .|..|.|.:       ..||.|..
 Frog   117 KIETLRLARNYIWALSDILEQGQSTEGKGFLEMLCKGLSQPTSNLVAGCM-------QLGPQAMF 174

  Fly   250 IPANSNAATICFEDTLASGGAFDCAILAATDGSLLNAATVTTSPAMQS-----IQSQAIHLQTPM 309
            :..:...:.:|                   |.||........||.:.|     |....:||:.|.
 Frog   175 LDKHEEKSHLC-------------------DSSLTGHTYNYQSPGLPSPPYGNIDVHHLHLKPPS 220

  Fly   310 EQQQQQASHLPH 321
            .:.....|.:.|
 Frog   221 FKPVMDPSVVSH 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/54 (56%)
neurod4NP_001124513.1 bHLH_TS_NeuroD4_ATOH3 <69..137 CDD:381564 33/67 (49%)
Neuro_bHLH 138..256 CDD:372170 22/121 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.