DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and neurog3

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_002935814.2 Gene:neurog3 / 100038294 XenbaseID:XB-GENE-876279 Length:226 Species:Xenopus tropicalis


Alignment Length:163 Identity:49/163 - (30%)
Similarity:77/163 - (47%) Gaps:37/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SNANGNASRRRK----------GALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEME 189
            |:..||..:::|          .....|:|..||:::|:|||.|||:||.|..:||.|:|....:
 Frog    55 SHPRGNERKKQKVKRMRSKVKSNTTVIKQRRNRRVKANDRERNRMHNLNSALDALRSVLPTFPDD 119

  Fly   190 RRLSKIETLTLAKNYIINLTHI-------ILSKRNEEAAALELNSGAVGGVLLSNLSSESGGPVA 247
            .:|:|||||..|.|||..|:..       :||.  |:...|:.........|:.:|||       
 Frog   120 AKLTKIETLRFAHNYIWALSETLRMADQSLLSP--EQQHLLDSLKKLPKSCLMMDLSS------- 175

  Fly   248 SGIPANSNAAT-------ICFED-TLASGGAFD 272
               |.:|.::|       ..|:| :|:..|:.|
 Frog   176 ---PTSSTSSTEWDSLYSPLFQDSSLSPTGSMD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 27/53 (51%)
neurog3XP_002935814.2 bHLH_TS_NGN3_ATOH5 80..147 CDD:381561 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.