DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mondo and INO4

DIOPT Version :9

Sequence 1:	NP_001163032.1	Gene:	Mondo / 35402	FlyBaseID:	FBgn0032940	Length:	1119	Species:	Drosophila melanogaster
Sequence 2:	NP_014533.1	Gene:	INO4 / 854042	SGDID:	S000005468	Length:	151	Species:	Saccharomyces cerevisiae

Alignment Length:	70	Identity:	22/70 - (31%)
Similarity:	35/70 - (50%)	Gaps:	2/70 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   909 DTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQLQLNPNAKLSKAAMLQKGADHIKQLRQERNVLK 973
            |.|.|..|:.:|:|||...:..||.|.|::|.||  |....|:..:..|...::..|.:....|:
Yeast    43 DGQIRINHVSSEKKRRELERAIFDELVAVVPDLQ--PQESRSELIIYLKSLSYLSWLYERNEKLR 105

  Fly   974 DKIEA 978
            .:|.|
Yeast   106 KQIIA 110

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mondo	NP_001163032.1	HLH	909..969	CDD:238036	19/59 (32%)
INO4	NP_014533.1	bHLH_scINO4_like	45..115	CDD:381409	21/68 (31%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3582
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900