DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mondo and MLX

DIOPT Version :9

Sequence 1:NP_001163032.1 Gene:Mondo / 35402 FlyBaseID:FBgn0032940 Length:1119 Species:Drosophila melanogaster
Sequence 2:NP_733752.1 Gene:MLX / 6945 HGNCID:11645 Length:298 Species:Homo sapiens


Alignment Length:276 Identity:80/276 - (28%)
Similarity:125/276 - (45%) Gaps:40/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   826 ANVTSP----LSVPVPTHQHSPKKS-ASLPMAVNSALHSPPL--GSKIHGIGLATAN-VGSNSLS 882
            |::.||    ||||....:.|...: |.:..|.:.....|.|  .|...|..::.|| :||.|.|
Human    41 ASLLSPKSPTLSVPRGCREDSSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSAS 105

  Fly   883 LSP-----ESTFHESQDSPLSPTTSLKFQPRDTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQLQ 942
            ..|     :|.:|:.         :.|...:|.:||| |..||||||..||.|:|.|..::|..|
Human   106 SVPNTDDEDSDYHQE---------AYKESYKDRRRRA-HTQAEQKRRDAIKRGYDDLQTIVPTCQ 160

  Fly   943 LNP----NAKLSKAAMLQKGADHIKQLRQERNVLKDKIEALRMERDELNNSLTHLHSILPANGAP 1003
            ...    :.|||||.:|||..|:|:.|.:|:...::::..||.:...|.....:...|:.|: ..
Human   161 QQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAH-QD 224

  Fly  1004 VTRQGTEHVRQLYDIYVRYNTMNDWKFWILGLILEPLLASYTSTVSSASLDELRRTAFLWVDQHC 1068
            ...:|.:.|..    .|::|....        |::.|..|:.:::|.||..||....|.|:::||
Human   225 NPHEGEDQVSD----QVKFNVFQG--------IMDSLFQSFNASISVASFQELSACVFSWIEEHC 277

  Fly  1069 SLIDLRPAVTNKLKYL 1084
            ....||..|...|..|
Human   278 KPQTLREIVIGVLHQL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MondoNP_001163032.1 HLH 909..969 CDD:238036 29/63 (46%)
MLXNP_733752.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 8/21 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..145 21/63 (33%)
HLH 130..188 CDD:306515 27/58 (47%)
Leucine-zipper 140..160 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.