DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mondo and mlx

DIOPT Version :9

Sequence 1:NP_001163032.1 Gene:Mondo / 35402 FlyBaseID:FBgn0032940 Length:1119 Species:Drosophila melanogaster
Sequence 2:XP_017209811.1 Gene:mlx / 554119 ZFINID:ZDB-GENE-050522-316 Length:253 Species:Danio rerio


Alignment Length:250 Identity:71/250 - (28%)
Similarity:112/250 - (44%) Gaps:55/250 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   875 NVGSNSLSLSPESTFHESQDSPLSPTTSLKFQPRDTQRRAGHIHAEQKRRYN------IKNGFDT 933
            ::||.|.|..|.:   :.:||.....|..|...:| :||..|..||||||.|      .:.|:|.
Zfish    45 SIGSTSASSVPNT---DDEDSDNRHETPYKESYKD-RRRHAHTQAEQKRRDNQGMCDAFQKGYDD 105

  Fly   934 LHALIPQLQLNPN-----AKLSKAAMLQKGADHIKQLRQERNVLKDKIEALRMERDELNNSLTHL 993
            |.:::|..|...:     .|:|||.:|||..|:|:.|.:|:...::.:..||.|...|....|:.
Zfish   106 LQSIVPTCQQQSDFSMATQKMSKATVLQKTIDYIQFLHKEKKKQEEDVSTLRKEVMALKIMKTNY 170

  Fly   994 HSILPAN-GAPVTRQGTEHVRQLYDIYVRYNTMNDWKFWILGLILEPLLASYTSTVSSASLDELR 1057
            ..|:.|: ..|  :||:|.|            .:..||.:...|::.|..|::::||.:|..||.
Zfish   171 EHIVKAHQNNP--QQGSEQV------------SDQVKFSVFQSIMDSLFQSFSASVSVSSFQELS 221

  Fly  1058 RTAFLWVDQHCSLIDLRPAVTNKLKYLSMHTDIVSEPPSTLQEEVAKALQNSSGQ 1112
            ...|.|:::||.                         |.||:|.|...||..:||
Zfish   222 ACVFSWIEEHCK-------------------------PQTLREFVVTVLQQVNGQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MondoNP_001163032.1 HLH 909..969 CDD:238036 26/70 (37%)
mlxXP_017209811.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.