DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mondo and mxl-2

DIOPT Version :9

Sequence 1:NP_001163032.1 Gene:Mondo / 35402 FlyBaseID:FBgn0032940 Length:1119 Species:Drosophila melanogaster
Sequence 2:NP_497173.1 Gene:mxl-2 / 175184 WormBaseID:WBGene00003510 Length:205 Species:Caenorhabditis elegans


Alignment Length:188 Identity:47/188 - (25%)
Similarity:81/188 - (43%) Gaps:32/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   883 LSPESTFHESQDSPLSPTTSLKFQPRDTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQLQLNPNA 947
            :||:.: ..|..:|.:|.|:......| :::|.|:..|::||..|.:|:..|..||||...:...
 Worm    21 MSPDGS-ASSPSAPNTPATNSGGFSSD-RKKATHLRCERQRREAINSGYSDLKDLIPQTTTSLGC 83

  Fly   948 KLSKAAMLQKGADHIKQLRQERNVLKDKIEALRMERDELNNSLTHLHSILP-----ANGAPVTRQ 1007
            |.:.||:|.:..|.:.||:.:   :.|..:.|.    :||.....|..|..     |:..|...|
 Worm    84 KTTNAAILFRACDFMSQLKTD---ISDADKQLA----QLNAQAAALEMIASEYEQMASSVPDAGQ 141

  Fly  1008 GTEHVRQLYDIYVRYNTMNDWKFWILGLILEPLLASYTSTVSSASLDELRRTAFLWVD 1065
            .|..|:                  :|.|:|:....|::|.|...:...:.||...||:
 Worm   142 STIQVK------------------MLQLLLDDCFTSFSSQVDFTTYATITRTLLSWVE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MondoNP_001163032.1 HLH 909..969 CDD:238036 20/59 (34%)
mxl-2NP_497173.1 bHLHzip_Mlx_like 47..110 CDD:381410 20/65 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.