DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8671 and fam102bb

DIOPT Version :9

Sequence 1:NP_001286124.1 Gene:CG8671 / 35400 FlyBaseID:FBgn0032938 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001038309.1 Gene:fam102bb / 557909 ZFINID:ZDB-GENE-041014-330 Length:367 Species:Danio rerio


Alignment Length:356 Identity:137/356 - (38%)
Similarity:168/356 - (47%) Gaps:118/356 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MMKKKKYKFNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEFPCK 78
            ||||||:||.|:.:|.:|..|..||.|||.|:|||||| |.|.||||.|:.:.|.|.:.|.||||
Zfish     1 MMKKKKFKFRVDFELDELSSVPFVNGVLFCKVRLLDGG-FSEESSRETVQANCVHWRKRFSFPCK 64

  Fly    79 MSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTSRRFLLEGYDSRH-RLD 142
            |||||.|||||||..|:|:|||:|||::|.||||.|||||||||:|.|:||.||||||::: |.|
Zfish    65 MSANAGTGVLDPCVCRVSVRKELKGGKTYAKLGFADLNLAEFAGSGSTTRRCLLEGYDTKNTRQD 129

  Fly   143 NSMLRVSIKMHMLSGDILFKAPTPNLKSKQSKPSIDDFSNAATGVGLQIPTATALPSIGGGSGGA 207
            ||:|:|.|...::|||..||.|          ||      .||.:|:|          |...|..
Zfish   130 NSILKVIISTQLMSGDPCFKTP----------PS------TATVIGIQ----------GDPEGLL 168

  Fly   208 SVSLGGSGVTLGGIPGNQSLPGTRPVSTTKEEDIDNQALIAAIVTDSGLSESSESGVTLTTDNLQ 272
            ....||                            |.|....::...||...|             
Zfish   169 EDRKGG----------------------------DTQKPFLSLSETSGKCSS------------- 192

  Fly   273 QHGSVVVANPISPVTQALP-QLGIIGSNNYGTTGGAIGFTGAGNATLIEMGHSRNSSNTSQMSKG 336
                             || :||:                         .||||.||..||.||.
Zfish   193 -----------------LPDELGL-------------------------CGHSRTSSYASQQSKV 215

  Fly   337 SGYSSFSHSQHSRQSSEGDSGHASRQNGQKG 367
            ||||    :.|||.||..:..|  |:|...|
Zfish   216 SGYS----TSHSRSSSLSEFSH--RRNTSIG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8671NP_001286124.1 NT-C2 22..161 CDD:287345 85/139 (61%)
fam102bbNP_001038309.1 NT-C2 10..148 CDD:287345 84/138 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578460
Domainoid 1 1.000 179 1.000 Domainoid score I3486
eggNOG 1 0.900 - - E1_28JCR
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 266 1.000 Inparanoid score I3026
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318637at33208
OrthoFinder 1 1.000 - - FOG0002357
OrthoInspector 1 1.000 - - otm26353
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21456
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3220
SonicParanoid 1 1.000 - - X1553
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.