DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8671 and FAM102A

DIOPT Version :9

Sequence 1:NP_001286124.1 Gene:CG8671 / 35400 FlyBaseID:FBgn0032938 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001030331.1 Gene:FAM102A / 399665 HGNCID:31419 Length:384 Species:Homo sapiens


Alignment Length:378 Identity:142/378 - (37%)
Similarity:180/378 - (47%) Gaps:111/378 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MAFMMKKKKYKFNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEF 75
            |||:|||||:||.....|::|..|..||.|||.|:||||||.|...||||||:.:.|.|.:.|.|
Human     1 MAFLMKKKKFKFQTTFTLEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWRKRFTF 65

  Fly    76 PCKMSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTSRRFLLEGYDSRH- 139
            .||||||.:||:||||..|:|:|||:|||::|.||||.|||||||||:|.|.|..||||||::: 
Human    66 VCKMSANPATGLLDPCVFRVSVRKELKGGKAYSKLGFADLNLAEFAGSGSTVRCCLLEGYDTKNT 130

  Fly   140 RLDNSMLRVSIKMHMLSGDILFKAPTPNLKSKQSKPSIDDFSNAATGVGLQIPTATALPSIGGGS 204
            |.|||:|:|:|.|.:||||..||.|....||                  :.||         |..
Human   131 RQDNSILKVTIGMFLLSGDPCFKTPPSTAKS------------------ISIP---------GQD 168

  Fly   205 GGASVSLGGSGVTLGGIPGNQSLPGTRPVSTTKEEDIDNQALIAAIVTDSGLSESSESGVTLTTD 269
            ....::..|.|.:.||...| ||.|:||...            ...:..|||.|..:..::    
Human   169 SSLQLTCKGGGTSSGGSSTN-SLTGSRPPKA------------RPTILSSGLPEEPDQNLS---- 216

  Fly   270 NLQQHGSVVVANPISPVTQALPQLGIIGSNNYGTTGGAIGFTGAGNATLIEMGHSRNSSNTSQMS 334
                          ||                              ..:...|||||||..||.|
Human   217 --------------SP------------------------------EEVFHSGHSRNSSYASQQS 237

  Fly   335 KGSGYSSFSHSQHSRQSSEGDSGHASRQN----------------GQKGDEHQ 371
            |.||||    ::|||.||..|..|  |:|                |.:|.|.:
Human   238 KISGYS----TEHSRSSSLSDLTH--RRNTSTSSSASGGLGMTVEGPEGSERE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8671NP_001286124.1 NT-C2 22..161 CDD:287345 82/139 (59%)
FAM102ANP_001030331.1 NT-C2 12..152 CDD:402120 82/139 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..315 43/179 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145143
Domainoid 1 1.000 179 1.000 Domainoid score I3541
eggNOG 1 0.900 - - E1_28JCR
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I2976
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318637at33208
OrthoFinder 1 1.000 - - FOG0002357
OrthoInspector 1 1.000 - - otm42150
orthoMCL 1 0.900 - - OOG6_106774
Panther 1 1.100 - - LDO PTHR21456
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3220
SonicParanoid 1 1.000 - - X1553
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.