DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8671 and FAM102B

DIOPT Version :9

Sequence 1:NP_001286124.1 Gene:CG8671 / 35400 FlyBaseID:FBgn0032938 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001010883.2 Gene:FAM102B / 284611 HGNCID:27637 Length:360 Species:Homo sapiens


Alignment Length:434 Identity:146/434 - (33%)
Similarity:199/434 - (45%) Gaps:133/434 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MMKKKKYKFNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEFPCK 78
            ||||||:||.|:.:|::|..|..||.|||.|:||||||||...||||.|:.:.|.|.:.|.|.||
Human     1 MMKKKKFKFKVDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVRWRKKFSFMCK 65

  Fly    79 MSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTSRRFLLEGYDSRH-RLD 142
            |||:|:||:||||..|:|:|||:|||::|.||||.|||||||||:|.|:||.||||||::: |.|
Human    66 MSASAATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQD 130

  Fly   143 NSMLRVSIKMHMLSGDILFKAPTPNLKSKQSKPSIDDFSNAATGVGLQIPTATALPSIGGGSGGA 207
            ||:|:|.|.|.::|||..||.|          ||                |:.::| |.|.|   
Human   131 NSILKVLISMQLMSGDPCFKTP----------PS----------------TSMSIP-IAGES--- 165

  Fly   208 SVSLGGSGVTLGGIPGNQSLPGTRPVSTTKEEDIDNQALIAAIVTDSGLSESSESGVTLTTDNLQ 272
                                                          ..|.|..:.|.|     |:
Human   166 ----------------------------------------------ESLQEDRKGGET-----LK 179

  Fly   273 QHGSVVVANPISPVTQALP-QLGIIGSNNYGTTGGAIGFTGAGNATLIEMGHSRNSSNTSQMSKG 336
            .|..:.   .:|..:.::| :||                         ..||||.||..||.||.
Human   180 VHLGIA---DLSAKSASVPDELG-------------------------ACGHSRTSSYASQQSKV 216

  Fly   337 SGYSSFSHSQHSRQSSEGDSGHASRQNGQKGDEH-------QQCNSLRVVVAKSHHVHTHLSLST 394
            ||||:.    |||.||..:..|  |:|...|...       :.|:.:...:|:.       :|.|
Human   217 SGYSTC----HSRSSSFSELCH--RRNTSVGSTSTGVESILEPCDEIEQKIAEP-------NLDT 268

  Fly   395 T-VEYASDEQLYQTP-NATMTNSQKLAFEDFRTPMAELAAPLFQ 436
            . .|..:.|:|.:.| ......||....:|.|....::...:.|
Human   269 ADKEDTASEKLSRCPVKQDSVESQLKRVDDTRVDADDIVEKILQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8671NP_001286124.1 NT-C2 22..161 CDD:287345 83/139 (60%)
FAM102BNP_001010883.2 NT-C2 9..149 CDD:371003 83/139 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145144
Domainoid 1 1.000 179 1.000 Domainoid score I3541
eggNOG 1 0.900 - - E1_28JCR
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I2976
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318637at33208
OrthoFinder 1 1.000 - - FOG0002357
OrthoInspector 1 1.000 - - otm42150
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21456
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3220
SonicParanoid 1 1.000 - - X1553
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.