DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8671 and SPCC1494.08c

DIOPT Version :9

Sequence 1:NP_001286124.1 Gene:CG8671 / 35400 FlyBaseID:FBgn0032938 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_588533.1 Gene:SPCC1494.08c / 2539001 PomBaseID:SPCC1494.08c Length:274 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:47/204 - (23%)
Similarity:87/204 - (42%) Gaps:36/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FMMKKKKYKFNVEVQLQDLVEVALVNEVLFAK--IRLLDGGSFQEYSSREEVRNHRVEWNRSFEF 75
            |:.|.::..|.:.:::.|:|.:.|:..|:|.|  |..:......:.:..|.|..|||.|    |:
pombe     4 FIPKARRPTFELHLRIHDVVNIPLITGVIFVKWNIEGIHSRHANDQTEAEPVLEHRVTW----EY 64

  Fly    76 PCKMSANA---STGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTSRRFLLEGYDS 137
            ...:|...   :..:|....|.:.:..:........:||.:.:||.|:...|..:|::||.  ||
pombe    65 ETCVSVRMIIDNDNLLKDKFLILQVLCDSHTDSGVIRLGILKINLTEYVYVGQDTRKYLLA--DS 127

  Fly   138 RHRLDNSMLRVSIKMHMLSGDILFKAPTPNLKSKQSKPSIDDFSNAATGVGL------------Q 190
            :   .|:.:|:.|.:...||:..|:     :.....||.:  ||..   .||            :
pombe   128 K---INATIRIGISLKQTSGNKDFR-----VSKTLGKPQV--FSGL---TGLLTDGKELKRRDDE 179

  Fly   191 IPTATALPS 199
            :.|:|.|.|
pombe   180 VYTSTGLAS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8671NP_001286124.1 NT-C2 22..161 CDD:287345 34/143 (24%)
SPCC1494.08cNP_588533.1 NT-C2 7..148 CDD:287345 35/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I3545
eggNOG 1 0.900 - - E1_28JCR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21456
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.