DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k14505 and ATPAF2

DIOPT Version :9

Sequence 1:NP_001260668.1 Gene:l(2)k14505 / 35399 FlyBaseID:FBgn0021856 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_663729.1 Gene:ATPAF2 / 91647 HGNCID:18802 Length:289 Species:Homo sapiens


Alignment Length:263 Identity:116/263 - (44%)
Similarity:165/263 - (62%) Gaps:4/263 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SQCKGAASSFTVRHYASPP--KRFYKKTSVLSGDSGYEVVLDHRKLKTPKGTPFIVRSEPLAIAV 81
            |...|.......|.||.|.  ||||:..|:..|:.|:|:.|||||||||:...|.|.||.|||||
Human    26 SMSPGPTIPSPARAYAPPTERKRFYQNVSITQGEGGFEINLDHRKLKTPQAKLFTVPSEALAIAV 90

  Fly    82 ATEFDAQKENIERSRMHLSALCFTAIDNPNHLSKLDMVNYLLNFIATDTVLFQYDDEKDLQDLQV 146
            |||:|:|::.|:...|||:.||.|::|||...:|..::...:.|:.|||:.::.::.:.|.:||.
Human    91 ATEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQR 155

  Fly   147 NEWDPVIAWFNQRYDTNLQKTMNITPPQVSEQDKMNVAKHFQSYSLETLHGFIFAVDTLKSIVLA 211
            |||||:|.|..:||...:..:.:|..|.:..:.:..:..|..||:...|.|..|....|||:||.
Human   156 NEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVLVSHLASYNTWALQGIEFVAAQLKSMVLT 220

  Fly   212 CAVIEQMLTVEKAVALARLEEEYQLKFWGRVEWAHDLSQQELQARLAAAVLFVHLNCSEN-LVKQ 275
            ..:|:..||||:||.|:|||||||::.||.:|||||...|||:||.||..||:|| |||: .||.
Human   221 LGLIDLRLTVEQAVLLSRLEEEYQIQKWGNIEWAHDYELQELRARTAAGTLFIHL-CSESTTVKH 284

  Fly   276 KII 278
            |::
Human   285 KLL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k14505NP_001260668.1 ATP12 39..159 CDD:284873 55/119 (46%)
ATPAF2NP_663729.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..40 3/13 (23%)
ATP12 48..166 CDD:311478 55/117 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154051
Domainoid 1 1.000 125 1.000 Domainoid score I5501
eggNOG 1 0.900 - - E1_COG5387
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34602
Inparanoid 1 1.050 227 1.000 Inparanoid score I3488
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63179
OrthoDB 1 1.010 - - D468631at33208
OrthoFinder 1 1.000 - - FOG0004839
OrthoInspector 1 1.000 - - oto91726
orthoMCL 1 0.900 - - OOG6_102681
Panther 1 1.100 - - LDO PTHR21013
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2042
SonicParanoid 1 1.000 - - X5183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.