DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k14505 and AT5G40660

DIOPT Version :9

Sequence 1:NP_001260668.1 Gene:l(2)k14505 / 35399 FlyBaseID:FBgn0021856 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_198882.1 Gene:AT5G40660 / 834066 AraportID:AT5G40660 Length:325 Species:Arabidopsis thaliana


Alignment Length:317 Identity:90/317 - (28%)
Similarity:141/317 - (44%) Gaps:71/317 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AIRALRLTNFS---------QCKGAASSFTVRHYASPP--------------------------- 37
            ||||..|...|         |...::||||.......|                           
plant    19 AIRARSLCTTSAARQPDSDTQPSESSSSFTFEKENEKPILVKAPNSRRKNESDSVTMPTSFMTGS 83

  Fly    38 ---KRFYKKTSVLSGD--SGYEVVLDHRKLKTPKGTPFIVRSEPLAIAVATEFDAQ-KENIERSR 96
               ||||||.:....|  :|:.|:||:|.||||...|..:||..||.|:|.|::.| .|.|....
plant    84 IVGKRFYKKVTTREADDGNGWTVMLDYRTLKTPSKRPLKLRSLALAKAIAAEWEYQLTEGIRPFT 148

  Fly    97 MHLSALCFTAIDN-PNHLSKLDMVNYLLNFIATDTVLFQYDDEKDL----QDLQVNEWDPVIAWF 156
            |.|..|..||::. |  |::..::.:|...|..|.|.|:..::.||    .|:||...||::.|.
plant   149 MPLMRLACTALERVP--LTRSKIIEHLSRKIHQDLVFFRAPEDNDLTSDVHDIQVESIDPLLEWI 211

  Fly   157 NQRYDTNLQKTMNITPPQV-------SEQDKMNVAKHFQSYSLETLHGFIFAVDTLK----SIVL 210
            ...:...         |:|       .:.||:  .|..:....:|..|.:.::|.|:    |||:
plant   212 ESEFRVK---------PKVYSSIFGGKQDDKL--VKAVEELLKKTNDGELASIDALQASAHSIVI 265

  Fly   211 ACAVIEQMLTVEKAVALARLEEEYQLKFWGRVEWAHDLSQQELQARLAAAVLFVHLN 267
            |..:....|.::.|:.|.||||:.|:..||.||..||:...:|:.::::|.:|:.|:
plant   266 ALGIFCGKLQIDDAIKLIRLEEDLQVDKWGLVEGGHDIDVADLKVQISSATVFLALS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k14505NP_001260668.1 ATP12 39..159 CDD:284873 46/127 (36%)
AT5G40660NP_198882.1 ATP12 88..212 CDD:400089 46/125 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3448
eggNOG 1 0.900 - - E1_COG5387
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34602
Inparanoid 1 1.050 107 1.000 Inparanoid score I2105
OMA 1 1.010 - - QHG63179
OrthoDB 1 1.010 - - D734341at2759
OrthoFinder 1 1.000 - - FOG0004839
OrthoInspector 1 1.000 - - oto3099
orthoMCL 1 0.900 - - OOG6_102681
Panther 1 1.100 - - LDO PTHR21013
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.