DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k14505 and atpaf2

DIOPT Version :9

Sequence 1:NP_001260668.1 Gene:l(2)k14505 / 35399 FlyBaseID:FBgn0021856 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_989036.1 Gene:atpaf2 / 394633 XenbaseID:XB-GENE-972826 Length:277 Species:Xenopus tropicalis


Alignment Length:274 Identity:122/274 - (44%)
Similarity:171/274 - (62%) Gaps:9/274 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AIRALRLTNFSQCKGAASSFTVRHYASPP---KRFYKKTSVLSGDSGYEVVLDHRKLKTPKGTPF 70
            ||.|.||..|.    ||.....|.||:..   |:||:..|:..|:.|:|:.||.|||:||:|..|
 Frog     7 AITARRLRVFP----AALCAQTRLYAAAATERKKFYENVSISHGEGGFEINLDRRKLRTPQGKIF 67

  Fly    71 IVRSEPLAIAVATEFDAQKENIERSRMHLSALCFTAIDNPNHLSKLDMVNYLLNFIATDTVLFQY 135
            ...||.||:|||||:|.|::.|:...|||:.||.||:|||...:|..::...|.|:.||||.::.
 Frog    68 TAPSEALAVAVATEWDCQRDVIKFYTMHLTTLCNTALDNPTLRNKEQLITAALKFLETDTVCYRV 132

  Fly   136 DDEKDLQDLQVNEWDPVIAWFNQRYDTNLQKTMNITPPQVSEQDKMNVAKHFQSYSLETLHGFIF 200
            ::...|.:||.|||||||.|..:||:..:..:.:|..|.:..:.|...::|..||:...|.|..|
 Frog   133 EEPPGLVELQRNEWDPVIEWAEKRYNVVIGSSTSIQGPIIPTETKDVFSRHLASYNSWGLLGIEF 197

  Fly   201 AVDTLKSIVLACAVIEQMLTVEKAVALARLEEEYQLKFWGRVEWAHDLSQQELQARLAAAVLFVH 265
            .:..|||:||...:|::.|.|||||.|:|||||||::.||.||||||...|||::|.||..||||
 Frog   198 IISQLKSLVLTMGLIDRHLPVEKAVLLSRLEEEYQIQRWGNVEWAHDYDLQELRSRTAAGTLFVH 262

  Fly   266 LNCSE-NLVKQKII 278
            | ||| :.:|.|::
 Frog   263 L-CSESSTIKHKLL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k14505NP_001260668.1 ATP12 39..159 CDD:284873 55/119 (46%)
atpaf2NP_989036.1 ATP12 36..154 CDD:369415 55/117 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5693
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34602
Inparanoid 1 1.050 219 1.000 Inparanoid score I3475
OMA 1 1.010 - - QHG63179
OrthoDB 1 1.010 - - D468631at33208
OrthoFinder 1 1.000 - - FOG0004839
OrthoInspector 1 1.000 - - oto105487
Panther 1 1.100 - - LDO PTHR21013
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2042
SonicParanoid 1 1.000 - - X5183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.