DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr39 and NR6A1

DIOPT Version :9

Sequence 1:NP_476932.1 Gene:Hr39 / 35398 FlyBaseID:FBgn0261239 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_201591.2 Gene:NR6A1 / 2649 HGNCID:7985 Length:480 Species:Homo sapiens


Alignment Length:416 Identity:129/416 - (31%)
Similarity:189/416 - (45%) Gaps:41/416 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 CPICGDKISGFHYGIFSCESCKGFFKRTVQNRKNYVCVRGGPCQVSISTRKKCPACRFEKCLQKG 440
            |.||||:.:|.||||.|||.|||||||::.|::.|.|.|...|.:|...|.:|..||..||||.|
Human    60 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMG 124

  Fly   441 MKLEAIREDRTRGGRSTYQCSYTLPNSMLSPLLSPDQAAAAAAAAAVASQQQPHQRLHQLNGFGG 505
            |..:|||||...|||          |..:.|:...::......:.....::..|...|..:....
Human   125 MNRKAIREDGMPGGR----------NKSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSS 179

  Fly   506 VPIPCSTSLPASPSLAGTSVKSEEMAETGKQSLRTG----SVPPLLQEIMDVEHLWQYTDAELAR 566
            .....|.|...||....:|.:|.|:  .|..:.|..    ||||..|.|   .||:.|:.     
Human   180 PGNRASESNQPSPGSTLSSSRSVEL--NGFMAFREQYMGMSVPPHYQYI---PHLFSYSG----- 234

  Fly   567 INQPLSAFASGSSSSSSSSGTSSGAHAQ----LTNPLLASAGLSSNGENANPDLIAHLCNVADHR 627
             :.||....:.|....|.|.......|:    |..|:|...|.:.    ...:|.|.||.:||..
Human   235 -HSPLLPQQARSLDPQSYSLIHQLLSAEDLEPLGTPMLIEDGYAV----TQAELFALLCRLADEL 294

  Fly   628 LYKIVKWCKSLPLFKNISIDDQICLLINSWCEL-LLFSCCFRSIDTPGEI-----KMSQGRKITL 686
            |::.:.|.|.||.|..:||.|..|||.::|.|| ||.|....|....||:     |.|...: .|
Human   295 LFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADVTAKYSPSDE-EL 358

  Fly   687 SQAKSNGLQTCIERMLNLTDHLRRLRVDRYEYVAMKVIVLLQSDTTELQEAVKVRECQEKALQSL 751
            .:....|::. |||::.|.....:|:|...||..||.|..|..|...|..|.::.:..::.....
Human   359 HRFSDEGMEV-IERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWYIC 422

  Fly   752 QAYTLAHYPDTPSKFGELLLRIPDLQ 777
            |.:|...|...|::|.:|::.:|:::
Human   423 QDFTEYKYTHQPNRFPDLMMCLPEIR 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr39NP_476932.1 NR_DBD_Lrh-1_like 376..468 CDD:143541 45/91 (49%)
NR_LBD_F2 617..779 CDD:132728 52/167 (31%)
NR6A1NP_201591.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
NR_DBD_GCNF_like 52..141 CDD:143543 44/90 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..150 8/28 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..199 6/36 (17%)
Sufficient for interaction with UIMC1. /evidence=ECO:0000250 172..253 23/91 (25%)
NR_LBD_DHR4_like 256..467 CDD:132751 58/199 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5991
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D278717at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto90780
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.