DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr39 and nhr-89

DIOPT Version :9

Sequence 1:NP_476932.1 Gene:Hr39 / 35398 FlyBaseID:FBgn0261239 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_493155.1 Gene:nhr-89 / 184026 WormBaseID:WBGene00003679 Length:310 Species:Caenorhabditis elegans


Alignment Length:289 Identity:69/289 - (23%)
Similarity:114/289 - (39%) Gaps:55/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 PCPICGDKISGF--HYGIFSCESCKGFFKRTVQNRKNYVCVRGGPCQVSISTRKKCPACRFEKCL 437
            ||.:| ..:.|.  |:||.:|.||..||:|:: |.|.| |.....|.:....::.|.:||:.||:
 Worm     7 PCRVC-HSVKGTRRHFGITACMSCSSFFRRSL-NCKFY-CPANNSCTILDDQKQFCRSCRYNKCV 68

  Fly   438 QKGMKLEAIRED--RTRGGRS-----TYQCSYTLPNSMLSPLLSPDQAAAAAAAAAVASQQQPHQ 495
            |.||:.:.:|:.  |.:.||.     ...||..|..|....|   :.....|..:....:|.|.:
 Worm    69 QSGMRRDCVRKQSYRRQAGRKEAKSPAVSCSNKLSESYEELL---NFYVKEANESIARKRQSPLK 130

  Fly   496 RLHQLNGFGGVPIPCSTSLPASPSLAGTSVKSEEMAETGKQSLRTGSVPPLLQ-------EIMDV 553
            ..||:.                        .|:|:.|..|...:| |:..:|.       :..|:
 Worm   131 NAHQVK------------------------TSKELLEISKSEDKT-SLDAVLHCYGTYILDDEDI 170

  Fly   554 EHLWQYTDAELARINQPLSAFASGSSSSSSSSGTSSGAHAQLTNPLLASAGLSSNGENANPDLIA 618
            ..|.:|.......|:   |||.. |.|:|:..........:....:..|.|||....|.|....|
 Worm   171 TTLIRYFKFMNTWID---SAFVY-SKSTSNEELLDGNDICKFAYQIDTSIGLSLKNLNLNIFEYA 231

  Fly   619 HLCNVADHRLYKIVKWCKSLPLFKNISID 647
            .|..:....|    |:.::.|..|:::::
 Worm   232 ALRAICIWNL----KFYETSPKMKSLALE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr39NP_476932.1 NR_DBD_Lrh-1_like 376..468 CDD:143541 32/100 (32%)
NR_LBD_F2 617..779 CDD:132728 6/31 (19%)
nhr-89NP_493155.1 ZnF_C4 7..75 CDD:197701 26/70 (37%)
metallo-dependent_hydrolases <121..>160 CDD:294200 11/63 (17%)
HOLI 150..292 CDD:214658 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.