DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr39 and nhr-44

DIOPT Version :9

Sequence 1:NP_476932.1 Gene:Hr39 / 35398 FlyBaseID:FBgn0261239 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_505313.1 Gene:nhr-44 / 179276 WormBaseID:WBGene00003634 Length:428 Species:Caenorhabditis elegans


Alignment Length:105 Identity:35/105 - (33%)
Similarity:53/105 - (50%) Gaps:5/105 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 LDTVGLGSSHPASPAGISRQQLINSPCPICGDKISGFHYGIFSCESCKGFFKRT-VQNRKNYVCV 413
            :|::   ||...|.:..|..:||:..|.:|.....|.|:|:.||.:|..||:|. |.:::.:.|.
 Worm     1 MDSI---SSPSTSSSASSTPKLISEKCLVCFQPSHGNHFGVDSCRACAAFFRRVFVTHKQQFPCR 62

  Fly   414 RG-GPCQVSISTRKKCPACRFEKCLQKGMKLEAIREDRTR 452
            .| ..|......|..|..||.:||...|||.:.|:.||.|
 Worm    63 EGDNKCTPDEWGRWSCKRCRSDKCFALGMKPDNIQRDRDR 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr39NP_476932.1 NR_DBD_Lrh-1_like 376..468 CDD:143541 28/79 (35%)
NR_LBD_F2 617..779 CDD:132728
nhr-44NP_505313.1 ZnF_C4 23..94 CDD:197701 24/70 (34%)
Hormone_recep 198..403 CDD:278530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.