DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8677 and ATXR6

DIOPT Version :9

Sequence 1:NP_001286123.1 Gene:CG8677 / 35397 FlyBaseID:FBgn0026577 Length:2663 Species:Drosophila melanogaster
Sequence 2:NP_197821.1 Gene:ATXR6 / 832503 AraportID:AT5G24330 Length:349 Species:Arabidopsis thaliana


Alignment Length:401 Identity:82/401 - (20%)
Similarity:146/401 - (36%) Gaps:108/401 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1347 VVPMKRART----VRKENADDLEEEDAEE----ACQKCGKSDHPEWILLCDTPTCNKGYHCSCLS 1403
            :|.::|.||    .|.|....:.:.|::.    .|::|.....|..:||||  .|:||:|..||.
plant     1 MVAVRRRRTQASNPRSEPPQHMSDHDSDSDWDTVCEECSSGKQPAKLLLCD--KCDKGFHLFCLR 63

  Fly  1404 PVLFYIPEGDWHCPPCQQEQL---IAALERQLEQYDTLVAQKQQERILAEEQAERERQELEAATL 1465
            |:|..:|:|.|.||.|.:.|:   ...::.::..:..:.......:|.:...:..::::..:..:
plant    64 PILVSVPKGSWFCPSCSKHQIPKSFPLIQTKIIDFFRIKRSPDSSQISSSSDSIGKKRKKTSLVM 128

  Fly  1466 AAKDENFKSEKEEDEDDRDDMAVGKAEKVKRRRGDGRINRRAAKRGTRRRRGNESDSSHRKSLGS 1530
            :.|..........::..|      :.|::             |...|..|..|...|:....:  
plant   129 SKKKRRLLPYNPSNDPQR------RLEQM-------------ASLATALRASNTKFSNELTYV-- 172

  Fly  1531 GSRSGSGSDSSSDNSTSFSDSDDEPIYKLRKRRQINVSYRLNEYDDLINSAL-KKEMDEVAGAGN 1594
                 ||....|.|..:|.....:.:.|                :.:...|| ||.||       
plant   173 -----SGKAPRSANQAAFEKGGMQVLSK----------------EGVETLALCKKMMD------- 209

  Fly  1595 LGRGKDISTI--------IEADKEKARRD-DLPTE-----DEVGNKEDG-EKDKQKSKSSGSSPS 1644
            ||....:..:        :|||  :..:| .:.||     |.:.|:||. :.|...:....|.||
plant   210 LGECPPLMVVFDPYEGFTVEAD--RFIKDWTIITEYVGDVDYLSNREDDYDGDSMMTLLHASDPS 272

  Fly  1645 SSEDEVPLKRSN--KF------KQPPAKKK-------------ARKL--TTLDVSSEED-----H 1681
            ......|.:|||  :|      ..|..:||             ||.|  ...|:|..|.     :
plant   273 QCLVICPDRRSNIARFISGINNHSPEGRKKQNLKCVRFNINGEARVLLVANRDISKGERLYYDYN 337

  Fly  1682 GSDEDFKTSSY 1692
            |.:.::.|..:
plant   338 GYEHEYPTEHF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8677NP_001286123.1 Ehrlichia_rpt 770..>1243 CDD:118064
PHD_RSF1 1373..1419 CDD:277018 20/45 (44%)
Sox_C_TAD <2107..>2186 CDD:288887
ATXR6NP_197821.1 PHD_RSF1 35..79 CDD:277018 20/45 (44%)
SET_ATXR5_6-like 211..349 CDD:380937 31/140 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007345
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.