DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg18b and AtATG18a

DIOPT Version :9

Sequence 1:NP_001260667.1 Gene:Atg18b / 35396 FlyBaseID:FBgn0032935 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_567132.4 Gene:AtATG18a / 825452 AraportID:AT3G62770 Length:425 Species:Arabidopsis thaliana


Alignment Length:373 Identity:109/373 - (29%)
Similarity:178/373 - (47%) Gaps:47/373 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MNFNQDFTSLSVLSPTGLRLFSISSQDKVEEIFAK--DNTEQIRIVERLFNSSLVVLV-----TA 63
            ::||||....:|.:..|.|:.:.   |...|||.:  |....:.:||.||..:::.||     ..
plant    81 LSFNQDHACFAVGTDRGFRILNC---DPFREIFRRDFDRGGGVAVVEMLFRCNILALVGGGPDPQ 142

  Fly    64 QKPNCLKMLHFKKKQDIC--NCFYPSEILCVRMNRQRLIVCLAESIHIHDIRDMKILHSIENIAP 126
            ..||  |::.:...|..|  ...:.|::..||:.|.|:||.|.:.|.:::..|:|::|.||.|| 
plant   143 YPPN--KVMIWDDHQGRCIGELSFRSDVRSVRLRRDRIIVVLEQKIFVYNFSDLKLMHQIETIA- 204

  Fly   127 NEQGLCALSLNSHLAFPVCQ--TSGELRIFNASKLRTGMTIRAHDTSLSALAFSPSGALLATASE 189
            |.:||||:|........||.  ..|::||.:.:..||.. :.|||:.::..|.:..|.||||||.
plant   205 NPKGLCAVSQGVGSMVLVCPGLQKGQVRIEHYASKRTKF-VMAHDSRIACFALTQDGHLLATASS 268

  Fly   190 RGTVIRVFCVKNGQRVQEFRRGVSCVRIASLVFSASGDFLCASSNTETVHVFKIDTRAVETVELK 254
            :||::|:|...:|...||.|||.....|.||.||::..:|..||:..|||||.:...:...|:  
plant   269 KGTLVRIFNTVDGTLRQEVRRGADRAEIYSLAFSSNAQWLAVSSDKGTVHVFGLKVNSGSQVK-- 331

  Fly   255 AIADVAAKSENSAKEAVASTAAEESCRPVASWGGMFSKAVSSLLLPTQVSEVLAQDRSFATVQLA 319
                   .|...|.:|..|:.:..    ::.:.|:..:..||             :.|.|..:|.
plant   332 -------DSSRIAPDATPSSPSSS----LSLFKGVLPRYFSS-------------EWSVAQFRLV 372

  Fly   320 QGGLKHICALTRVQKEPRLLIACEDGFLYVHEFPAERGGPCKLMSVHD 367
            : |.::|.|... ||...:::.. ||..|..:|....||....:..|:
plant   373 E-GTQYIAAFGH-QKNTVVILGM-DGSFYRCQFDPVNGGEMSQLEYHN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg18bNP_001260667.1 WD40 <9..281 CDD:225201 90/282 (32%)
WD40 repeat 79..122 CDD:293791 13/44 (30%)
WD40 <89..242 CDD:295369 61/154 (40%)
WD40 repeat 130..166 CDD:293791 12/37 (32%)
WD40 repeat 172..208 CDD:293791 14/35 (40%)
WD40 repeat 212..257 CDD:293791 14/44 (32%)
AtATG18aNP_567132.4 WD40 <134..320 CDD:421866 68/189 (36%)
WD40 repeat 169..204 CDD:293791 13/34 (38%)
WD40 repeat 209..246 CDD:293791 11/37 (30%)
WD40 repeat 254..288 CDD:293791 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54442
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.