DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg18b and CG11975

DIOPT Version :9

Sequence 1:NP_001260667.1 Gene:Atg18b / 35396 FlyBaseID:FBgn0032935 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001262394.1 Gene:CG11975 / 41074 FlyBaseID:FBgn0037648 Length:340 Species:Drosophila melanogaster


Alignment Length:388 Identity:97/388 - (25%)
Similarity:163/388 - (42%) Gaps:77/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FNQDFTSLSVLSPTGLRLFSISS-QDKVEEIFAKDNTEQIRIVERLFNSSLVVLV-----TAQKP 66
            ||||....:..:.||.|:::... ::|..:.|.:.....   ||.||..:.:.||     ....|
  Fly    18 FNQDQGCFACATDTGFRVYNCDPLKEKERQYFPEGGLSH---VEMLFRCNYLALVGGGIRPLYPP 79

  Fly    67 NCLKMLHFKKKQDICNCFYPSEILCVRMNRQRLIVCLAESIHIHDI-RDMKILHSIENIAPNEQG 130
            |.:.:....||....:..:...:..||:.|.|::|.|...|.:... :..:.||..|. :.|..|
  Fly    80 NKVIVWDDLKKSPAISLDFNQPVRAVRLRRDRIVVVLEGVIKVFTFTQQPQQLHVFET-SSNPNG 143

  Fly   131 LCAL---SLNSHLAFPVCQTSGELRIFN-ASKLRTGMTIRAHDTSLSALAFSPSGALLATASERG 191
            ||.|   |..|.||||..:| |.::|.: |:..|..:.:.||:..:|.:|.:..|..||||.|:|
  Fly   144 LCVLCPHSNKSLLAFPGRRT-GHVQIVDLANTERAPLEVIAHEAGISCIALNLQGTRLATAGEKG 207

  Fly   192 TVIRVFCVKNGQRVQEFRRGVSCVRIASLVFSASGDFLCASSNTETVHVFKIDTRAVETVELKAI 256
            |:||:|..::|::|.|.|||.:...|..:.|:.....:..:|:..|:|||.::            
  Fly   208 TLIRIFDTESGKKVSELRRGSNHANIFCINFNHQSTMVVVASDHGTIHVFNLE------------ 260

  Fly   257 ADVAAKSENSAKEAVASTAAEESCRPVASWGGMFSKAVSSLLLPTQVSEVLAQDRSFATVQLAQG 321
                   :|..:|                         |||.:   :.:..:...||....:.||
  Fly   261 -------DNKPRE-------------------------SSLPI---IPKYFSSQWSFVKFSIPQG 290

  Fly   322 GLKHICALTRVQKEPRLLIA-CEDGFLYVHEFPAERGGPCKLMSVHDLRGALEDVIELELSES 383
            . :.:||.   ..:|..::| |.||..|  :|.....|.|.       |......:||:..|:
  Fly   291 P-RCVCAF---GADPNSVVAICADGHYY--KFLFNNKGECS-------RDICTQFLELQDDET 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg18bNP_001260667.1 WD40 <9..281 CDD:225201 74/282 (26%)
WD40 repeat 79..122 CDD:293791 9/43 (21%)
WD40 <89..242 CDD:295369 53/157 (34%)
WD40 repeat 130..166 CDD:293791 15/39 (38%)
WD40 repeat 172..208 CDD:293791 15/35 (43%)
WD40 repeat 212..257 CDD:293791 7/44 (16%)
CG11975NP_001262394.1 WD40 repeat 102..136 CDD:293791 9/33 (27%)
WD40 141..>265 CDD:421866 44/143 (31%)
WD40 repeat 145..180 CDD:293791 13/35 (37%)
WD40 repeat 188..225 CDD:293791 16/36 (44%)
WD40 repeat 233..273 CDD:293791 12/86 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11227
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.