DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg18b and wipi2

DIOPT Version :9

Sequence 1:NP_001260667.1 Gene:Atg18b / 35396 FlyBaseID:FBgn0032935 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_031748991.1 Gene:wipi2 / 100497399 XenbaseID:XB-GENE-6084294 Length:435 Species:Xenopus tropicalis


Alignment Length:392 Identity:171/392 - (43%)
Similarity:232/392 - (59%) Gaps:62/392 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NFNQDFTSLSVLSPTGLRLFSISSQDKVEEIFAKDNTEQIRIVERLFNSSLVVLVTAQKPNCLKM 71
            |||||.|||:|.|.:|.:.||:||.||:|:|:..::||.:.||||||:||||.:|:.:.|..||:
 Frog    19 NFNQDNTSLAVGSKSGYKFFSLSSVDKLEQIYECNDTEDVCIVERLFSSSLVAIVSLKAPRKLKV 83

  Fly    72 LHFKKKQDICNCFYPSEILCVRMNRQRLIVCLAESIHIHDIRDMKILHSIENIAPNEQGLCALSL 136
            .||||..:|||..|.:.||.|::|||||||||.||::||:|||||:||:|....||..||||||:
 Frog    84 CHFKKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPSGLCALSI 148

  Fly   137 NS---HLAFPVCQTSGELRIFNASKLRTGMTIRAHDTSLSALAFSPSGALLATASERGTVIRVFC 198
            |.   :||:|...:.||:::|:...||....|.|||:.|:||||..||..||||||:|||||||.
 Frog   149 NGENCYLAYPGSASIGEVQVFDTVNLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVFS 213

  Fly   199 VKNGQRVQEFRRGVS-CVRIASLVFSASGDFLCASSNTETVHVFKIDTRAVETVELKAIADVAAK 262
            :..||::.||||||. ||.|.||.||....||.|||||||||:||::|                 
 Frog   214 IPEGQKLFEFRRGVKRCVSICSLAFSMDSIFLSASSNTETVHIFKLET----------------- 261

  Fly   263 SENSAKEAVASTAAEESCRPVASWGGMFSKAV--SSLLLPTQVSEVLAQDRSFATVQLAQGGLKH 325
                    :....:||.    .||.|.|.:.:  |:..||:||:|:..|.|:||||:|...|.|:
 Frog   262 --------IKEKPSEEP----TSWTGYFGRVIMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKN 314

  Fly   326 ICA------------------LTRVQKE---------PRLLIACEDGFLYVHEFPAERGGPCKLM 363
            |||                  ||.:.:|         |..|....:|.|::.:.|.:....||.:
 Frog   315 ICALATTYSWKTLNKRRLLKPLTDMLREKGIQFRWGFPFSLTVRNNGQLFILKTPKDTDDFCKKL 379

  Fly   364 SV 365
            .:
 Frog   380 DI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg18bNP_001260667.1 WD40 <9..281 CDD:225201 137/275 (50%)
WD40 repeat 79..122 CDD:293791 27/42 (64%)
WD40 <89..242 CDD:295369 91/156 (58%)
WD40 repeat 130..166 CDD:293791 15/38 (39%)
WD40 repeat 172..208 CDD:293791 22/35 (63%)
WD40 repeat 212..257 CDD:293791 22/45 (49%)
wipi2XP_031748991.1 WD40 <21..272 CDD:225201 137/279 (49%)
WD40 repeat 58..99 CDD:293791 22/40 (55%)
WD40 repeat 144..181 CDD:293791 13/36 (36%)
WD40 repeat 187..224 CDD:293791 23/36 (64%)
WD40 repeat 231..259 CDD:293791 18/27 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216824at2759
OrthoFinder 1 1.000 - - FOG0001466
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.