DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8679 and CG42391

DIOPT Version :9

Sequence 1:NP_610099.1 Gene:CG8679 / 35395 FlyBaseID:FBgn0032934 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster


Alignment Length:273 Identity:96/273 - (35%)
Similarity:135/273 - (49%) Gaps:61/273 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 KQLIKYKRNTEALLAAQKHAQDAQIRYSVELHRTLRSPEDFARINDYLPHEATSAAHFAQCGVTK 502
            |..:|.:..:.:|....||    ...:|.||..|:.|..:|..|::.:                 
  Fly    22 KSKVKARPISYSLGTLHKH----HTNFSTELENTINSESNFKNISNLI----------------- 65

  Fly   503 KNMREGHLK----------QSFIYMLIDPRISRNLPGESAFLEKFGVWQRFLDSIFYIGKGKCSR 557
            |.:|: |.|          ..|.|:|:|||::.||...::.|....||..||.:|||:||||.:|
  Fly    66 KFVRQ-HSKWYRDNDCINRHYFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATR 129

  Fly   558 PYAHLYDAMRQHTRLHQKREKDKTNRERGGGFRTLQPDVFRSPPPGDGKMGSRKLERILDIWQHG 622
            ||.||.:|         ::..|:||.      .||..|              .||..|:.||:..
  Fly   130 PYVHLKNA---------QKLVDETNN------ITLVKD--------------PKLALIVSIWKAN 165

  Fly   623 SGVVCLHVFHNILPIDAYTREASIIDALGLNHLTNIKRGDYYGPAQSWTMKQKKQLGIALLFKAM 687
            .||:.:..|..|...||.|||||||||||:|||||.:.|.|||.|:|.:.|::|.||||||:|.|
  Fly   166 RGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLGFYYGRARSLSDKERKYLGIALLYKLM 230

  Fly   688 HIYLAEGESQLSP 700
            ..:||:.|.:|.|
  Fly   231 MKFLAKEEKELFP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8679NP_610099.1 ANK 15..133 CDD:238125
ANK repeat 42..78 CDD:293786
Ank_5 67..121 CDD:290568
ANK repeat 80..111 CDD:293786
LEM 404..447 CDD:128813 2/8 (25%)
GIY-YIG_COG3680_Meta 513..657 CDD:198401 57/143 (40%)
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 21/85 (25%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 57/143 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471855
Domainoid 1 1.000 86 1.000 Domainoid score I5156
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451150at2759
OrthoFinder 1 1.000 - - FOG0005201
OrthoInspector 1 1.000 - - otm14805
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3306
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.