DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8679 and F44E5.15

DIOPT Version :9

Sequence 1:NP_610099.1 Gene:CG8679 / 35395 FlyBaseID:FBgn0032934 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_001254314.1 Gene:F44E5.15 / 13187261 WormBaseID:WBGene00206377 Length:222 Species:Caenorhabditis elegans


Alignment Length:181 Identity:50/181 - (27%)
Similarity:72/181 - (39%) Gaps:50/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 IDPRISRNLPGESAF-----------LE--KFGVWQRFLDSIFYIGKGKCSRPYAHLYDAMRQHT 570
            :|.:|..:.||.:|.           ||  ||   ..|:..|||:|||...|...|..:|:    
 Worm    48 VDEQIKLDFPGTTAHCYLLLHPTLLGLEDVKF---DNFVSYIFYVGKGTGFRSLHHFIEAL---- 105

  Fly   571 RLHQKREKDKTNRERGGGFRTLQPDVFRSPPPGDGKMGSRKLERILDIWQHGSGVVCLHVFHNIL 635
                ::|.|                     |..|.|.||     |:.||..|..:.|:.:|..:.
 Worm   106 ----QKEND---------------------PYIDSKCGS-----IVSIWNSGQEIGCVKIFVGVS 140

  Fly   636 PIDAYTREASIIDALGLNHLTNIKRGDYYGPAQSWTMKQKKQLGIALLFKA 686
            ...|..:||::|.||..:.|||...|.:.|.:..|..|.|.|.|...:.||
 Worm   141 STVAQIKEAAMIKALSKHDLTNKIEGSFLGLSNIWNNKDKCQYGSFCIRKA 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8679NP_610099.1 ANK 15..133 CDD:238125
ANK repeat 42..78 CDD:293786
Ank_5 67..121 CDD:290568
ANK repeat 80..111 CDD:293786
LEM 404..447 CDD:128813
GIY-YIG_COG3680_Meta 513..657 CDD:198401 39/150 (26%)
F44E5.15NP_001254314.1 GIY-YIG_COG3680_Meta <76..162 CDD:198401 32/122 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451150at2759
OrthoFinder 1 1.000 - - FOG0005201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3306
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.