DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clumsy and Ir7f

DIOPT Version :9

Sequence 1:NP_001036373.1 Gene:clumsy / 35394 FlyBaseID:FBgn0026255 Length:1002 Species:Drosophila melanogaster
Sequence 2:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster


Alignment Length:430 Identity:77/430 - (17%)
Similarity:139/430 - (32%) Gaps:138/430 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 PVNGLDVLNDDEESEKRVGQKLSNKTFIVSSRLGAPF--LTLREPQEGEIL----TGNSRYEGYS 449
            |||..|      ..:.:..|...:|   :|...|.|.  ||..:|...|::    ...||..|:.
  Fly   202 PVNTFD------GRKWKASQMFPDK---LSQMHGCPLTVLTWHQPPFVELVWDPKHNRSRGSGFE 257

  Fly   450 IDLINEIAKMLNFKFEF----RMSPDGKYGALNKVTQTWDGIVRQLIDGNADLGICDLTMTSSRR 510
            |.|:..:|:.:||..|.    .:.|:    |......:.:|.:.:|:..|.::.:.....|:.|.
  Fly   258 IQLVEHLARRMNFSLELVNIALLRPN----AYRLAEGSSEGPIEKLLQRNVNISMGYFRKTARRN 318

  Fly   511 QAVDFTPPFMTLGISILFSKPPTPPTDLFSFLSPFSLDVWIYM---------------------- 553
            |.:.....:.:..:..:..........|...:.||.|.||:.:                      
  Fly   319 QLLTTPMSYYSANLVAVLQLERYRIGSLALLVFPFELSVWMLLLLALLIHLGIHLPSARRGNEED 383

  Fly   554 -GSAYLFISLLL-FALARMAPDDWENPHPCKEPEEVENIWS-------------------IMNTT 597
             |.....::||| .||||: |..|.:....     ...:|:                   :.||.
  Fly   384 GGGGLQVVALLLGAALARL-PRSWRHRFIA-----AHWLWASIPLRISYQSLLFHLIRLQLYNTP 442

  Fly   598 WLSIGSLMGQGCDILPKAASTRLVTGM------------------WWFFALMMLNSYTAN----- 639
            ..|:..|:.:|...:..|.:.||:..|                  |     .:||..|.|     
  Fly   443 SFSLDQLLAEGFQGICTANTQRLLLEMPQLARDPDSIQSVDTPFDW-----DVLNVLTRNRNRKI 502

  Fly   640 --------LAAFLTNSRQANSINSAEDLAAQSKIKYGAMAGGSTMGFFRDSNFSTYQKMWTAMES 696
                    ..:||.:|...|:.:..:.   ...::|.        |.:...:...|:||      
  Fly   503 FAVANQDVTLSFLHSSAHPNAFHVVKQ---PVNVEYA--------GMYMPKHSFLYEKM------ 550

  Fly   697 ASPSVFTKTNDEGVERVQKGKNLYAFLMESTTLEYNVERK 736
                      |:.:.|:.....::|:...|..   :|.||
  Fly   551 ----------DDDIRRLDASGFIHAWRRASFA---SVHRK 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clumsyNP_001036373.1 PBP1_iGluR_Kainate 26..396 CDD:107377 3/4 (75%)
ANF_receptor 39..379 CDD:279440
PBP2_iGluR_Kainate 414..787 CDD:270432 72/407 (18%)
Lig_chan 548..812 CDD:278489 43/263 (16%)
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 25/130 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.