DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clumsy and ZK867.2

DIOPT Version :9

Sequence 1:NP_001036373.1 Gene:clumsy / 35394 FlyBaseID:FBgn0026255 Length:1002 Species:Drosophila melanogaster
Sequence 2:NP_001355384.1 Gene:ZK867.2 / 191445 WormBaseID:WBGene00022829 Length:354 Species:Caenorhabditis elegans


Alignment Length:269 Identity:60/269 - (22%)
Similarity:106/269 - (39%) Gaps:40/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MVGSIFTSDKDESEIAFRTAVDRANILERNVELVPIVVYANTDDSF-IMEKMVCNLISQGVIAIF 89
            |:|.:.:...|...::.|.|.:|..::   :...|..|:..:..|| :..:|:..:|   :||.|
 Worm    72 MIGLLQSDQLDMIGLSMRIAPEREEVV---LFSYPTRVFETSIQSFPVSSRMLLLII---LIATF 130

  Fly    90 GPSTGSSSDIIASICDTLDIPHIVYDWIPNESIPDR----EHSTMTLNVHPDNLLLSQGLAEIVQ 150
            ..|....:|::|    .|.:| :.|. ||..||...    ||..|.:....:..||   ......
 Worm   131 FISQLYQTDMLA----FLSVP-LTYS-IPFRSIKQALELVEHQKMYIAAFENQTLL---CTPTTC 186

  Fly   151 SFAWRSF--TVVYETDKELQQLQDILQVGEPISNPTTVKQLGPGDDHRPFLKEIK-LSTDNCLIL 212
            |...:|.  ..|...:|: .::||:::.| .|...|....|.||        ::. |:.|...::
 Worm   187 SLFQKSIDKNPVRRANKD-TEVQDLIKKG-GIYQSTVDSALLPG--------QLSWLNVDQKFLI 241

  Fly   213 ---HCAPDNLLKILQQANELKMLGEYQSVFIPLLDTHS-IDFGELSGVEANITTVRLMDP-SDFH 272
               ..||...:.........|:|.::.|..|.:|...| |..|.....:.....:|..:| |...
 Worm   242 VRDEDAPSYYVAFTFSKKHKKLLKKFNSALIEVLPAVSLITIGHGYNTKKKPFEIRTTNPRSSLS 306

  Fly   273 VKNVVHDWE 281
            :.|  |.|:
 Worm   307 INN--HLWQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clumsyNP_001036373.1 PBP1_iGluR_Kainate 26..396 CDD:107377 60/269 (22%)
ANF_receptor 39..379 CDD:279440 57/256 (22%)
PBP2_iGluR_Kainate 414..787 CDD:270432
Lig_chan 548..812 CDD:278489
ZK867.2NP_001355384.1 Lig_chan-Glu_bd 22..77 CDD:214911 2/4 (50%)
Periplasmic_Binding_Protein_Type_2 <69..>103 CDD:389745 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.