DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clumsy and T25E4.2

DIOPT Version :9

Sequence 1:NP_001036373.1 Gene:clumsy / 35394 FlyBaseID:FBgn0026255 Length:1002 Species:Drosophila melanogaster
Sequence 2:NP_001364710.1 Gene:T25E4.2 / 188897 WormBaseID:WBGene00020804 Length:455 Species:Caenorhabditis elegans


Alignment Length:244 Identity:53/244 - (21%)
Similarity:92/244 - (37%) Gaps:47/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 RYEGYSIDLINEIAKMLNFKFEFRM-SPDGKYGALNKVTQTW---------DGIVRQLID----G 494
            |..||..|:  ....:.|:.:.|.. .|..:...||...|..         |..:.|.||    |
 Worm     9 RAVGYQTDV--PYVSLSNYCWSFNCPKPGAEVEFLNMTFQLMNSTATIVQIDADIEQSIDMVSNG 71

  Fly   495 NADLGICDLTMTSSRRQAVDFTPP--FMTLGISILFSKPPTPPTDLFSFLSPF-SLDVWIYMG-- 554
            :||:.:.....|..|.:.||||.|  |:..|. ::...|.....|....|..: :|.:.|..|  
 Worm    72 SADITLVSARQTLDRMKKVDFTTPIGFVYYGY-LVREIPELAVADYIMRLFDYDTLAILISFGLI 135

  Fly   555 -SAYLFISLLLFALARMAPDDWENPHPCKEPEEVENIWSIMNTTWLSIGSLMGQGCDILPKAAST 618
             .|.|::...:|.|                     .:.|:::..::|...::.|....:......
 Worm   136 IGALLYLYTWIFGL---------------------RVRSLLDWMFISCSGIIHQFMFRISSPICA 179

  Fly   619 RLVTGMWWFFALMMLNSYTANLAAFLTNSRQANSI-NSAEDL--AAQSK 664
            .::.|.|....|:::..|.|.|.:||..|....:| |:.:.:  ||:.|
 Worm   180 LVLIGFWLLCCLVIITYYEAKLKSFLLLSHHRGTIFNTLDGVLEAAEHK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clumsyNP_001036373.1 PBP1_iGluR_Kainate 26..396 CDD:107377
ANF_receptor 39..379 CDD:279440
PBP2_iGluR_Kainate 414..787 CDD:270432 53/244 (22%)
Lig_chan 548..812 CDD:278489 23/123 (19%)
T25E4.2NP_001364710.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.