DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and FHL5

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001164278.1 Gene:FHL5 / 9457 HGNCID:17371 Length:284 Species:Homo sapiens


Alignment Length:177 Identity:54/177 - (30%)
Similarity:79/177 - (44%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAIT--KRMITALGKTWHPEHFLCHHCDEQI-LDATFNVQSGEPVCNKCFVERYTYTCAG 68
            |..|:..|.  .|.:...|..||...|:|.:|.:.| .....:.:||. .|..||.:.:.:.|..
Human   102 CFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGN-YCVPCFEKEFAHYCNF 165

  Fly    69 CKKPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPI 133
            |||.|....|....:.||:.||.|.| |:|.|..:.|..||..|:|...|.:|:|.:|..|.|||
Human   166 CKKVITSGGITFCDQLWHKECFLCSG-CRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPI 229

  Fly   134 TD----SAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            :.    ..:...:.:||..||.|.||...:..:.|.....:..|..|
Human   230 SGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 14/53 (26%)
LIM 66..118 CDD:351770 20/51 (39%)
LIM 125..176 CDD:214528 14/54 (26%)
FHL5NP_001164278.1 LIM <5..34 CDD:351770
LIM1_FHL 37..95 CDD:188729
LIM2_FHL5 102..155 CDD:188812 14/53 (26%)
LIM3_FHL 163..214 CDD:188732 20/51 (39%)
LIM4_FHL 222..277 CDD:188733 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.