DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and PDLIM1

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_066272.1 Gene:PDLIM1 / 9124 HGNCID:2067 Length:329 Species:Homo sapiens


Alignment Length:71 Identity:18/71 - (25%)
Similarity:26/71 - (36%) Gaps:15/71 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|.||...|....:....:..|||.::|..|...:      .|.|.     .|||...|    |:
Human   259 MCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNL------KQKGH-----FFVEDQIY----CE 308

  Fly    71 KPILEK 76
            |...|:
Human   309 KHARER 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 11/50 (22%)
LIM 66..118 CDD:351770 3/11 (27%)
LIM 125..176 CDD:214528
PDLIM1NP_066272.1 PDZ_signaling 10..82 CDD:238492
DUF4749 138..230 CDD:318205
LIM_CLP36 260..311 CDD:188832 17/65 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.