DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and PDLIM1

DIOPT Version :10

Sequence 1:NP_724318.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_066272.1 Gene:PDLIM1 / 9124 HGNCID:2067 Length:329 Species:Homo sapiens


Alignment Length:71 Identity:18/71 - (25%)
Similarity:26/71 - (36%) Gaps:15/71 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|.||...|....:....:..|||.::|..|...:      .|.|.     .|||...|    |:
Human   259 MCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNL------KQKGH-----FFVEDQIY----CE 308

  Fly    71 KPILEK 76
            |...|:
Human   309 KHARER 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_724318.1 LIM 7..58 CDD:413332 11/50 (22%)
LIM 66..118 CDD:413332 3/11 (27%)
LIM 125..176 CDD:214528
PDLIM1NP_066272.1 PDZ_PDLIM-like 6..83 CDD:467235
DUF4749 138..231 CDD:464948
LIM_CLP36 260..311 CDD:188832 17/65 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.