DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and WLIM1

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_172491.1 Gene:WLIM1 / 837558 AraportID:AT1G10200 Length:190 Species:Arabidopsis thaliana


Alignment Length:160 Identity:35/160 - (21%)
Similarity:56/160 - (35%) Gaps:48/160 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYT---- 65
            :.|.|....:.|  :||..:.:|...|.||||...:..:.:|...|...|...|.:.:..|    
plant    11 MACDKTVYLVDK--LTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQNFKRTGSLE 73

  Fly    66 ------------------------------------CAGCKKPI--LEKTICAMGERWHEACF-C 91
                                                |.||.|.:  :|| :...|..:|::|| |
plant    74 KSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK-VSVNGTLYHKSCFKC 137

  Fly    92 CGGACKKPLASQTFYERDGKPYCKQDYENL 121
            ..|.|  .::...:...:||.|||..:..|
plant   138 THGGC--TISPSNYIAHEGKLYCKHHHIQL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 14/50 (28%)
LIM 66..118 CDD:351770 18/54 (33%)
LIM 125..176 CDD:214528
WLIM1NP_172491.1 LIM1_SF3 6..68 CDD:188824 15/58 (26%)
LIM2_SF3 110..170 CDD:188825 19/59 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.