DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and DAR7

DIOPT Version :10

Sequence 1:NP_724318.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001190637.1 Gene:DAR7 / 836793 AraportID:AT5G66610 Length:587 Species:Arabidopsis thaliana


Alignment Length:153 Identity:44/153 - (28%)
Similarity:61/153 - (39%) Gaps:33/153 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAIT-KRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            :|..|:.||. .|.:.|||..||||.|.|.:||:.|....|:...|.  |:....||....|..|
plant   200 ICDGCKSAIEYGRSVHALGVNWHPECFCCRYCDKPIAMHEFSNTKGR--CHITCYERSHPNCHVC 262

  Fly    70 KKPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEK--P 132
            ||..       .|.::.|..|.....|       .|:|.||.|            :|..||:  |
plant   263 KKKF-------PGRKYKEHPFWKEKYC-------PFHEVDGTP------------KCCSCERLEP 301

  Fly   133 ITDSAVLAMNVKWHRNCFQCNKC 155
            .....|:..:.:|  .|.:|.:|
plant   302 WGTKYVMLADNRW--LCVKCMEC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_724318.1 LIM 7..58 CDD:413332 20/51 (39%)
LIM 66..118 CDD:413332 13/51 (25%)
LIM 125..176 CDD:214528 9/33 (27%)
DAR7NP_001190637.1 LIM_DA1 201..252 CDD:188782 20/52 (38%)
DA1-like 343..580 CDD:463530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.