DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and AT4G36860

DIOPT Version :10

Sequence 1:NP_724318.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001328324.1 Gene:AT4G36860 / 829839 AraportID:AT4G36860 Length:577 Species:Arabidopsis thaliana


Alignment Length:153 Identity:41/153 - (26%)
Similarity:62/153 - (40%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITK-RMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            :|..||..|.. |.::.:|..||||.|.|:.||:.|:|..|::....|....|:.|::...|..|
plant   213 ICVGCQAEIGHGRFLSCMGGVWHPECFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKCDVC 277

  Fly    70 KKPILEKTICAMGERWHEACFCCGGACKKPLASQTF---YERDGKPYCKQDYENLFAARCAKCEK 131
            ...|.......:..|.|            |...|.:   :||||.|            ||..||:
plant   278 HNFIPTNPAGLIEYRAH------------PFWMQKYCPSHERDGTP------------RCCSCER 318

  Fly   132 --PITDSAVLAMNVKWHRNCFQC 152
              | .|:..|.:: ...:.|.:|
plant   319 MEP-KDTKYLILD-DGRKLCLEC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_724318.1 LIM 7..58 CDD:413332 18/51 (35%)
LIM 66..118 CDD:413332 12/54 (22%)
LIM 125..176 CDD:214528 9/30 (30%)
AT4G36860NP_001328324.1 LIM_DA1 214..266 CDD:188782 18/51 (35%)
DA1-like 363..573 CDD:463530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.