DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and PLIM2a

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_182104.1 Gene:PLIM2a / 819188 AraportID:AT2G45800 Length:226 Species:Arabidopsis thaliana


Alignment Length:156 Identity:38/156 - (24%)
Similarity:59/156 - (37%) Gaps:43/156 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI-TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSG----EPVCNKCFVERYTYT- 65
            |..|.:.: ...::|..|.|:|...|.|.||...::.:.::...|    :|...:.|.|...|: 
plant    10 CKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYCKPHFEQLFKESGNYSK 74

  Fly    66 -------------------------------CAGCKKPI--LEKTICAMGERWHEACF-CCGGAC 96
                                           ||.|||.:  ||| :...||.:|:.|| |....|
plant    75 NFQAGKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEK-VTMEGESYHKTCFRCTHSGC 138

  Fly    97 KKPLASQTFYERDGKPYCKQDYENLF 122
              ||...::...:|..|||..:..||
plant   139 --PLTHSSYASLNGVLYCKVHFNQLF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 12/55 (22%)
LIM 66..118 CDD:351770 21/54 (39%)
LIM 125..176 CDD:214528
PLIM2aNP_182104.1 LIM1_SF3 6..68 CDD:188824 13/57 (23%)
LIM 106..166 CDD:413332 23/60 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.