DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Pdlim7

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001107560.1 Gene:Pdlim7 / 67399 MGIID:1914649 Length:457 Species:Mus musculus


Alignment Length:170 Identity:64/170 - (37%)
Similarity:92/170 - (54%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            |||:|.:.|..|.:.|||..:|||.|:|..|.:.:.:..|..:.|...|..|:..||...||.||
Mouse   281 VCHQCHKIIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPSCYDVRYAPNCAKCK 345

  Fly    71 KPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPIT- 134
            |.|..:.:.|:...||..||.| .|||.|:.::.||..:|.|||::|||.:|..:|..|:..|. 
Mouse   346 KKITGEIMHALKMTWHVHCFTC-AACKTPIRNRAFYMEEGAPYCERDYEKMFGTKCRGCDFKIDA 409

  Fly   135 -DSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVC 173
             |..:.|:...||..||.|..|:..:..:||....|||:|
Mouse   410 GDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDKPLC 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 17/50 (34%)
LIM 66..118 CDD:351770 22/51 (43%)
LIM 125..176 CDD:214528 17/51 (33%)
Pdlim7NP_001107560.1 PDZ_signaling 5..79 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..226
LIM1_Enigma 282..333 CDD:188836 17/50 (34%)
LIM2_Enigma 341..392 CDD:188840 22/51 (43%)
LIM3_Enigma 400..454 CDD:188842 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3566
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.