DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Fhl2

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_113865.1 Gene:Fhl2 / 63839 RGDID:61963 Length:279 Species:Rattus norvegicus


Alignment Length:215 Identity:62/215 - (28%)
Similarity:95/215 - (44%) Gaps:38/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTESIVCHKCQEAI-TKRMI------------------------TALG----------KTWHPEH 30
            |||...||.|.|:: .|:.|                        |.:|          :.||...
  Rat     1 MTERFDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGC 65

  Fly    31 FLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKKPILEKT--ICAMGERWHEACFCCG 93
            |.|..|...::|..|..:..:.:|..|:...|:..|..|||.|:..|  :...|..|||.||.| 
  Rat    66 FHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTC- 129

  Fly    94 GACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITDSAVLAMNVKWHRNCFQCNKCENP 158
            ..|::|:.:::|..::.:.:|...||..:|.:|.:|:||||...|...:..|||.||.|..|:..
  Rat   130 QRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYRDQPWHRECFVCTACKKQ 194

  Fly   159 ITSQTFTIDGDKPVCPACNC 178
            ::.|.||...:.|.|..|.|
  Rat   195 LSGQRFTARDEFPYCLTCFC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 16/85 (19%)
LIM 66..118 CDD:351770 17/53 (32%)
LIM 125..176 CDD:214528 19/50 (38%)
Fhl2NP_113865.1 LIM <5..33 CDD:413332 6/27 (22%)
LIM 36..97 CDD:413332 11/60 (18%)
LIM2_FHL2 101..157 CDD:188810 19/56 (34%)
LIM 162..218 CDD:413332 21/53 (40%)
LIM4_FHL2 221..278 CDD:188817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10711
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104605
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.