DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and synpo2la

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_009305650.2 Gene:synpo2la / 563843 ZFINID:ZDB-GENE-090828-4 Length:1179 Species:Danio rerio


Alignment Length:36 Identity:10/36 - (27%)
Similarity:15/36 - (41%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPV 53
            |:|:|....||:..........||..|.:..:..||
Zfish   737 MVTSLATDMHPKGIAISSQTSSILTPTASETTSSPV 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 10/36 (28%)
LIM 66..118 CDD:351770
LIM 125..176 CDD:214528
synpo2laXP_009305650.2 PDZ_signaling 5..84 CDD:238492
TrbI 336..>516 CDD:329122
Atrophin-1 <491..961 CDD:331285 10/36 (28%)
DNA_pol3_gamma3 <1014..1178 CDD:331207
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.