DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Pdlim5

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006501801.1 Gene:Pdlim5 / 56376 MGIID:1927489 Length:734 Species:Mus musculus


Alignment Length:170 Identity:64/170 - (37%)
Similarity:89/170 - (52%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|..|.:.|....:.||||:||||.|.|.||...:....|..:.|...|..|:.:.:...|..|:
Mouse   557 MCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQ 621

  Fly    71 KPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPIT- 134
            :.||.:.|.|:.:.||.:||.| .||.||:.:..|:..||:|||:.||..||...|..||.||. 
Mouse   622 RKILGEVINALKQTWHVSCFVC-VACGKPIRNNVFHLEDGEPYCETDYYALFGTICRGCEFPIEA 685

  Fly   135 -DSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVC 173
             |..:.|:...||..||.|:.|...:..|||....|||:|
Mouse   686 GDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLC 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 18/50 (36%)
LIM 66..118 CDD:351770 21/51 (41%)
LIM 125..176 CDD:214528 20/51 (39%)
Pdlim5XP_006501801.1 PDZ_signaling 10..82 CDD:238492
PHA03307 150..>540 CDD:223039
DUF4749 214..315 CDD:374237
LIM1_ENH 558..609 CDD:188837 18/50 (36%)
LIM2_ENH 617..668 CDD:188841 21/51 (41%)
LIM3_ENH 676..730 CDD:188843 20/50 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.