DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and lpxn

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_689239.4 Gene:lpxn / 560743 ZFINID:ZDB-GENE-081105-159 Length:405 Species:Danio rerio


Alignment Length:168 Identity:66/168 - (39%)
Similarity:96/168 - (57%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKK 71
            |..|.:.|..:||||||:.||||||:|..|.|::....|..:.|:|.|.|.:.:.::..||.||.
Zfish   172 CASCGKCIAGKMITALGQVWHPEHFVCSACREELGTCGFFERDGKPYCEKDYQKLFSPRCAYCKG 236

  Fly    72 PILEKTICAMGERWH-EACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITD 135
            ||.:..:.||.:.|| |..|||  .|......:.:.||||||||.:|:..|||.:|:.|.:|:.:
Zfish   237 PITQNILTAMDQTWHPEHFFCC--HCGDLFGPEGYLERDGKPYCSRDFYCLFAPKCSGCGEPVKE 299

  Fly   136 SAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVC 173
            :.:.|.|..||.:||.|:.|..|.|...|.....:|:|
Zfish   300 NYLSAANGTWHPDCFVCSDCLKPFTDGCFLELNGRPLC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 23/50 (46%)
LIM 66..118 CDD:351770 23/52 (44%)
LIM 125..176 CDD:214528 16/49 (33%)
lpxnXP_689239.4 LIM1_Paxillin_like 172..224 CDD:259830 23/51 (45%)
LIM2_Leupaxin 231..282 CDD:188792 23/52 (44%)
LIM3_Leupaxin 290..342 CDD:188794 16/48 (33%)
LIM4_Leupaxin 349..400 CDD:188796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583861
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D249616at33208
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.