DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and fhl3b

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001093448.1 Gene:fhl3b / 555053 ZFINID:ZDB-GENE-030131-8356 Length:290 Species:Danio rerio


Alignment Length:179 Identity:58/179 - (32%)
Similarity:84/179 - (46%) Gaps:15/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI--TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            ||:|:|.|  ..|.:....:.:|.:.|.|..|...:...:|..|....|||.|:...::..|..|
Zfish    40 CHECKELIEHNSRELYHEDRHYHEQCFRCSRCSRSLAKESFTCQEDALVCNNCYCNEFSSNCVAC 104

  Fly    70 KKPI------LEKTICAMGERWHEACF-CCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCA 127
            .|.:      ||...|.    |||.|| |||  |::|:.:|:|.....:.||...||..||.|||
Zfish   105 GKTVMPGSKRLEYEDCV----WHEECFVCCG--CEQPIGAQSFIPDKDEYYCVPCYEGRFAPRCA 163

  Fly   128 KCEKPITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            .|::.:....|...:..||:.||.|..|:..:..|.||..|:.|.|..|
Zfish   164 HCKQTLVQGGVTYRDEPWHKECFLCTGCKVQLAGQPFTTQGEDPYCVKC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 15/52 (29%)
LIM 66..118 CDD:351770 20/58 (34%)
LIM 125..176 CDD:214528 17/50 (34%)
fhl3bNP_001093448.1 LIM <5..33 CDD:295319
LIM1_FHL3 36..94 CDD:188807 16/53 (30%)
LIM2_FHL3 98..155 CDD:188811 20/62 (32%)
LIM3_FHL 162..213 CDD:188732 17/51 (33%)
LIM4_FHL3 221..276 CDD:188818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11189
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4575
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.