Sequence 1: | NP_001163031.1 | Gene: | CG31624 / 35393 | FlyBaseID: | FBgn0051624 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021334342.1 | Gene: | lims2 / 553696 | ZFINID: | ZDB-GENE-050522-56 | Length: | 378 | Species: | Danio rerio |
Alignment Length: | 233 | Identity: | 59/233 - (25%) |
---|---|---|---|
Similarity: | 88/233 - (37%) | Gaps: | 64/233 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYT------ 65
Fly 66 --------------------------------------------------------CAGCKKPIL 74
Fly 75 EKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITDSAVL 139
Fly 140 AMNVKWHRNCFQCNKCENPITSQTFTIDGD-KPVCPAC 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31624 | NP_001163031.1 | LIM | 7..58 | CDD:351770 | 18/50 (36%) |
LIM | 66..118 | CDD:351770 | 19/51 (37%) | ||
LIM | 125..176 | CDD:214528 | 17/51 (33%) | ||
lims2 | XP_021334342.1 | LIM1_PINCH | 57..115 | CDD:188717 | |
LIM2_PINCH | 118..169 | CDD:188718 | 18/50 (36%) | ||
LIM3_PINCH | 182..231 | CDD:188719 | 0/48 (0%) | ||
LIM4_PINCH | 237..290 | CDD:188720 | 19/53 (36%) | ||
LIM5_PINCH | 298..351 | CDD:188721 | 18/52 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |