DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Pdlim1

DIOPT Version :10

Sequence 1:NP_724318.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_059061.1 Gene:Pdlim1 / 54133 RGDID:68324 Length:327 Species:Rattus norvegicus


Alignment Length:91 Identity:22/91 - (24%)
Similarity:34/91 - (37%) Gaps:17/91 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LASQTFYERDGK--PYCKQDYENL------FAARCAKCEK-PITD---SAVLAMNVKW-----HR 147
            |..|...|.|||  |.....:.::      .||.....:| ||.|   :.::.:.||.     |.
  Rat   215 LVLQEILESDGKGDPNKPSGFRSVKAPVTKVAASVGNAQKLPICDKCGTGIVGVFVKLRDHHPHP 279

  Fly   148 NCFQCNKCENPITSQTFTIDGDKPVC 173
            .|:.|..|...:..:.....||:..|
  Rat   280 ECYVCTDCGINLKQKGHFFVGDQIYC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_724318.1 LIM 7..58 CDD:413332
LIM 66..118 CDD:413332 7/19 (37%)
LIM 125..176 CDD:214528 13/58 (22%)
Pdlim1NP_059061.1 PDZ_PDLIM-like 6..83 CDD:467235
DUF4749 136..232 CDD:464948 7/16 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..186
LIM_CLP36 258..309 CDD:188832 10/48 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.