| Sequence 1: | NP_724318.1 | Gene: | CG31624 / 35393 | FlyBaseID: | FBgn0051624 | Length: | 178 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001361581.1 | Gene: | Pdlim3 / 53318 | MGIID: | 1859274 | Length: | 364 | Species: | Mus musculus |
| Alignment Length: | 49 | Identity: | 15/49 - (30%) |
|---|---|---|---|
| Similarity: | 22/49 - (44%) | Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVC 54 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31624 | NP_724318.1 | LIM | 7..58 | CDD:413332 | 15/48 (31%) |
| LIM | 66..118 | CDD:413332 | |||
| LIM | 125..176 | CDD:214528 | |||
| Pdlim3 | NP_001361581.1 | PDZ_PDLIM-like | 4..82 | CDD:467235 | |
| DUF4749 | 184..268 | CDD:464948 | |||
| LIM_ALP | 294..346 | CDD:188834 | 15/48 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||