DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Pdlim3

DIOPT Version :10

Sequence 1:NP_724318.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001361581.1 Gene:Pdlim3 / 53318 MGIID:1859274 Length:364 Species:Mus musculus


Alignment Length:49 Identity:15/49 - (30%)
Similarity:22/49 - (44%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVC 54
            :|.||...|...::.|..|..|||.|:|..|:..:....:....||..|
Mouse   293 LCDKCGSGIVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYC 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_724318.1 LIM 7..58 CDD:413332 15/48 (31%)
LIM 66..118 CDD:413332
LIM 125..176 CDD:214528
Pdlim3NP_001361581.1 PDZ_PDLIM-like 4..82 CDD:467235
DUF4749 184..268 CDD:464948
LIM_ALP 294..346 CDD:188834 15/48 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.