powered by:
Protein Alignment CG31624 and Pdlim3
DIOPT Version :9
Sequence 1: | NP_001163031.1 |
Gene: | CG31624 / 35393 |
FlyBaseID: | FBgn0051624 |
Length: | 178 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001361581.1 |
Gene: | Pdlim3 / 53318 |
MGIID: | 1859274 |
Length: | 364 |
Species: | Mus musculus |
Alignment Length: | 49 |
Identity: | 15/49 - (30%) |
Similarity: | 22/49 - (44%) |
Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVC 54
:|.||...|...::.|..|..|||.|:|..|:..:....:....||..|
Mouse 293 LCDKCGSGIVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYC 341
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1703 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.