DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Lims1

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_017457250.1 Gene:Lims1 / 499443 RGDID:1560732 Length:407 Species:Rattus norvegicus


Alignment Length:234 Identity:65/234 - (27%)
Similarity:86/234 - (36%) Gaps:65/234 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQS-----------------GEPVC 54
            ||:|.|.|..|:|.|:..:||||.|.|..|.|.:.|..|...:                 |:.:|
  Rat   142 CHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYIC 206

  Fly    55 NKCFV-------------------------------------ERYTY---------TCAGCKKPI 73
            .||..                                     |.|..         .|..|::||
  Rat   207 QKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPI 271

  Fly    74 LEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITDSAV 138
            ..:.:.|||::||...|.| ..|:||......|||.|..||:..|..||...|..|.:.|....|
  Rat   272 EGRVVNAMGKQWHVEHFVC-AKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVV 335

  Fly   139 LAMNVKWHRNCFQCNKCENPIT-SQTFTIDGDKPVCPAC 176
            .|:|..|..:||.|:.|...:| ...|.....||||..|
  Rat   336 SALNKAWCVSCFACSTCNTKLTLKDKFVAIDLKPVCKYC 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 21/67 (31%)
LIM 66..118 CDD:351770 20/51 (39%)
LIM 125..176 CDD:214528 17/51 (33%)
Lims1XP_017457250.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.