DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Ldb3

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006252699.3 Gene:Ldb3 / 498587 RGDID:1564875 Length:771 Species:Rattus norvegicus


Alignment Length:170 Identity:59/170 - (34%)
Similarity:89/170 - (52%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|..|...|....:.|:|::||||.|.|.:|...:.|..|..:.....|.:|:.:.:...||.|.
  Rat   594 LCGHCNNVIRGPFLVAMGRSWHPEEFNCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPICAKCN 658

  Fly    71 KPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPIT- 134
            ..|:.:.:.|:.:.||..||.| .|||||..:..|:..||:|||::||.|||:.:|..|:.|:. 
  Rat   659 TKIMGEVMHALRQTWHTTCFIC-AACKKPFGNSLFHMEDGEPYCEKDYINLFSTKCHGCDFPVEA 722

  Fly   135 -DSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVC 173
             |..:.|:...||..||.|..|...:..|.|....|||:|
  Rat   723 GDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKDKPLC 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 15/50 (30%)
LIM 66..118 CDD:351770 21/51 (41%)
LIM 125..176 CDD:214528 17/51 (33%)
Ldb3XP_006252699.3 PDZ_signaling 50..126 CDD:238492
DUF4749 240..341 CDD:406377
PHA03247 <426..576 CDD:223021
LIM1_ZASP_Cypher 595..646 CDD:188838 15/50 (30%)
LIM2_Enigma_like 654..705 CDD:188748 21/51 (41%)
LIM3_ZASP_Cypher 713..767 CDD:188844 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.