DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and fhl3

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001008165.1 Gene:fhl3 / 493527 XenbaseID:XB-GENE-947662 Length:279 Species:Xenopus tropicalis


Alignment Length:177 Identity:59/177 - (33%)
Similarity:88/177 - (49%) Gaps:7/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAIT--KRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            |..|::.:.  .|.:...|:|||...|:|:.|.:.|...:|..::....|..|:..:....|..|
 Frog   101 CISCEKTVMPGSRKLEYNGQTWHEHCFICNSCQQPIGSRSFIPENQNHYCIPCYESKLAPRCTHC 165

  Fly    70 KKPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPIT 134
            ||.:.:..:....|.||:.||.|.| ||..||.|.|..:|.||||.:.:.||:|.:||.|.||||
 Frog   166 KKSLTKGGVTYRDEPWHKECFVCTG-CKTQLAGQQFTSQDEKPYCIKCFGNLYAKKCAGCTKPIT 229

  Fly   135 D----SAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPACN 177
            .    ..|......||.:||.|::|...:..:.|..|.:..:|.|||
 Frog   230 GFGGAKYVSFEERHWHHSCFNCSRCSTSLVGKGFIPDNEDILCRACN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 13/52 (25%)
LIM 66..118 CDD:351770 22/51 (43%)
LIM 125..176 CDD:214528 17/54 (31%)
fhl3NP_001008165.1 LIM <5..33 CDD:351770
LIM1_FHL3 36..94 CDD:188807
LIM2_FHL3 98..155 CDD:188811 14/53 (26%)
LIM3_FHL 162..213 CDD:188732 22/51 (43%)
LIM4_FHL3 221..276 CDD:188818 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.