DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and fhl2b

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001006028.2 Gene:fhl2b / 450007 ZFINID:ZDB-GENE-041010-121 Length:279 Species:Danio rerio


Alignment Length:179 Identity:58/179 - (32%)
Similarity:93/179 - (51%) Gaps:5/179 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SIVCHKCQEAI--TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTC 66
            |..|.:|::.|  ..|.::...:.||.:.|.|..|...::|..|:.:..:.:|.:|:...|:..|
Zfish    37 SNTCEECKKPIGCNSRDLSYKDRHWHDDCFHCFKCHRSLVDKPFSTKDEQLLCTECYSNEYSSKC 101

  Fly    67 AGCKKPIL--EKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKC 129
            ..|||.|:  .:.:...|..|||.||.| ..|::|:.:::|..:|...||...||..||.:|.:|
Zfish   102 FECKKTIMPGSRKMEHKGNSWHETCFTC-QRCQQPIGTKSFIPKDNSNYCVPCYEKQFALQCVQC 165

  Fly   130 EKPITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPACNC 178
            :||||...|...:..||::||.|..|:..::.|.||...|.|.|..|.|
Zfish   166 KKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 12/52 (23%)
LIM 66..118 CDD:351770 18/53 (34%)
LIM 125..176 CDD:214528 19/50 (38%)
fhl2bNP_001006028.2 LIM <7..33 CDD:295319
LIM 36..97 CDD:295319 14/59 (24%)
LIM 101..157 CDD:295319 20/56 (36%)
LIM3_Fhl2 162..218 CDD:188815 21/53 (40%)
LIM4_FHL2 221..278 CDD:188817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11189
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4575
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104605
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.