DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and fhl1

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001006703.1 Gene:fhl1 / 448334 XenbaseID:XB-GENE-964257 Length:296 Species:Xenopus tropicalis


Alignment Length:174 Identity:50/174 - (28%)
Similarity:76/174 - (43%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQE--AITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            |.:|::  .:..:.:....:.||...|.|..|...:.:..|..:..:.:|.||.....:..|:||
 Frog    56 CAECRKPIGVDSKELHYKNRYWHDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTREDSLRCSGC 120

  Fly    70 KKPILE--KTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKP 132
            .|.|..  :.:...|..|||.||.|.. ||:.:.|.:|:.:....||...:|..||..|.||..|
 Frog   121 HKQIQPGGRNVEYKGSAWHEECFTCSN-CKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNP 184

  Fly   133 ITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            ||...:...:..||.:||.|..|...:..|.||...|...|..|
 Frog   185 ITSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 10/52 (19%)
LIM 66..118 CDD:351770 18/53 (34%)
LIM 125..176 CDD:214528 17/50 (34%)
fhl1NP_001006703.1 LIM1_FHL1 56..109 CDD:188730 10/52 (19%)
LIM2_FHL1 117..174 CDD:188808 19/57 (33%)
LIM3_FHL1 178..230 CDD:188813 18/51 (35%)
LIM4_FHL1 233..296 CDD:188734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.