DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and fhl5

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001004112.1 Gene:fhl5 / 445475 ZFINID:ZDB-GENE-040822-3 Length:280 Species:Danio rerio


Alignment Length:176 Identity:56/176 - (31%)
Similarity:80/176 - (45%) Gaps:7/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAIT--KRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            |..|::.:.  .|.:...|.:||...|||..|.:.|...:|..:.....|..||.:::.|.|..|
Zfish   102 CSTCKKTVMPGSRKMEYKGNSWHETCFLCQRCQQPIGTKSFIPKDNNYFCVPCFEKQFAYQCCAC 166

  Fly    70 KKPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPIT 134
            ||.|....:....:.||..||.|.| ||:.||.|.|..|:..|||...:.||:|.:|..|.|.||
Zfish   167 KKAITTGGVTYHDKPWHRECFTCIG-CKRQLAGQRFTSRENYPYCLDCFSNLYAKKCVGCTKAIT 230

  Fly   135 DSA----VLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            ..|    :.....:||..||.|.:|...:..:.|....|..:|..|
Zfish   231 SLAGAKYISFEERQWHSECFTCMQCSVSLVGRGFLTQRDDILCTDC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 13/52 (25%)
LIM 66..118 CDD:351770 21/51 (41%)
LIM 125..176 CDD:214528 15/54 (28%)
fhl5NP_001004112.1 LIM <6..34 CDD:295319
LIM1_FHL 37..95 CDD:188729
LIM 102..158 CDD:295319 15/55 (27%)
LIM3_FHL 163..214 CDD:188732 21/51 (41%)
LIM4_FHL 222..277 CDD:188733 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11189
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4575
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104605
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.