| Sequence 1: | NP_001163031.1 | Gene: | CG31624 / 35393 | FlyBaseID: | FBgn0051624 | Length: | 178 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001003732.1 | Gene: | fhl2a / 445277 | ZFINID: | ZDB-GENE-040808-49 | Length: | 279 | Species: | Danio rerio |
| Alignment Length: | 215 | Identity: | 60/215 - (27%) |
|---|---|---|---|
| Similarity: | 94/215 - (43%) | Gaps: | 38/215 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MTESIVCHKCQEAI-----------------------------------TKRMITALGKTWHPEH 30
Fly 31 FLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKKPIL--EKTICAMGERWHEACFCCG 93
Fly 94 GACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITDSAVLAMNVKWHRNCFQCNKCENP 158
Fly 159 ITSQTFTIDGDKPVCPACNC 178 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31624 | NP_001163031.1 | LIM | 7..58 | CDD:351770 | 13/85 (15%) |
| LIM | 66..118 | CDD:351770 | 18/53 (34%) | ||
| LIM | 125..176 | CDD:214528 | 18/50 (36%) | ||
| fhl2a | NP_001003732.1 | LIM | <7..33 | CDD:295319 | 4/25 (16%) |
| LIM1_FHL2 | 36..97 | CDD:188806 | 10/60 (17%) | ||
| LIM2_FHL2 | 101..157 | CDD:188810 | 20/56 (36%) | ||
| LIM3_Fhl2 | 162..218 | CDD:188815 | 20/53 (38%) | ||
| LIM | 221..278 | CDD:295319 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 54 | 1.000 | Domainoid score | I11189 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 133 | 1.000 | Inparanoid score | I4575 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_104605 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X39 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 5.860 | |||||