Sequence 1: | NP_001163031.1 | Gene: | CG31624 / 35393 | FlyBaseID: | FBgn0051624 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_731242.1 | Gene: | stck / 40999 | FlyBaseID: | FBgn0020249 | Length: | 348 | Species: | Drosophila melanogaster |
Alignment Length: | 245 | Identity: | 61/245 - (24%) |
---|---|---|---|
Similarity: | 92/245 - (37%) | Gaps: | 77/245 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATF------------NVQ-----SGEPVC 54
Fly 55 NKC--------------FVERYTYT---------------------------------------- 65
Fly 66 --CAGCKKPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAK 128
Fly 129 CEKPITDSAVLAMNVKWHRNCFQCNKCENPIT--SQTFTIDGDKPVCPAC 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31624 | NP_001163031.1 | LIM | 7..58 | CDD:351770 | 21/81 (26%) |
LIM | 66..118 | CDD:351770 | 19/51 (37%) | ||
LIM | 125..176 | CDD:214528 | 16/52 (31%) | ||
stck | NP_731242.1 | LIM1_PINCH | 21..79 | CDD:188717 | |
LIM2_PINCH | 82..133 | CDD:188718 | 15/50 (30%) | ||
LIM3_PINCH | 146..206 | CDD:188719 | 4/59 (7%) | ||
LIM4_PINCH | 212..265 | CDD:188720 | 19/53 (36%) | ||
LIM5_PINCH | 273..326 | CDD:188721 | 17/53 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 50 | 1.000 | Domainoid score | I3371 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 56 | 1.000 | Inparanoid score | I2587 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 1 | 1.000 | - | - | otm47179 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
6 | 5.960 |